REL Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86140-1-RR (same clone as 86140-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 86140-1-RR (REL antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86140-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86140-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86140-1-RR against Human REL were performed. The affinity constant is below 1 pM.

REL Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86140-1-PBS

Clone No.250180A1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C Rel, Proto oncogene c Rel

---

Product Information

86140-1-PBS targets REL in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26803

  Product name: Recombinant human REL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 279-471 aa of NM_001291746

  Sequence: MYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVG

• Full Name: v-rel reticuloendotheliosis viral oncogene homolog (avian)
• Calculated Molecular Weight: 69 kDa
• Observed Molecular Weight: 68-78 kDa
• GenBank Accession Number: NM_001291746
• Gene Symbol: REL
• Gene ID (NCBI): 5966
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q04864
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

REL, also known as, Proto-oncogene c-Rel, is a 619 amino acid protein, which may play a role in differentiation and lymphopoiesis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The NF-kappa-B heterodimer RELA/p65-c-Rel is a transcriptional activator.