RENALASE Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RENALASE Polyclonal antibody, PBS Only (15003-1-PBS)

• 

  WB analysis using 15003-1-AP (same clone as 15003-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15003-1-AP (RENALASE antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15003-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 15003-1-AP (same clone as 15003-1-PBS)

  IP result of anti-RENALASE (IP:15003-1-AP, 4ug; Detection:15003-1-AP 1:500) with HEK-293 cells lysate 2000ug. This data was developed using the same antibody clone with 15003-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 15003-1-AP (same clone as 15003-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 15003-1-AP (RENALASE antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15003-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 15003-1-AP (same clone as 15003-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 15003-1-AP (RENALASE antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15003-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse kidney using 15003-1-AP (same clone as 15003-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using RENALASE antibody (15003-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15003-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 15003-1-AP (same clone as 15003-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using 15003-1-AP (RENALASE antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15003-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RENALASE Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Cat No. 15003-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA

Synonyms

---

Product Information

15003-1-PBS targets RENALASE in WB, IHC, IF/ICC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13061

  Product name: Recombinant human RENALASE protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-342 aa of BC005364

  Sequence: MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI

• Full Name: chromosome 10 open reading frame 59
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC005364
• Gene Symbol: RENALASE
• Gene ID (NCBI): 55328
• RRID: AB_1557298
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VYX0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RNLS, also named as Renalase, C10orf59 and MAO-C, belongs to the renalase family. It is probable FAD-dependent amine oxidase secreted by the kidney, which circulates in blood and modulates cardiac function and systemic blood pressure. RNLS degrades catecholamines such as dopamine, norepinephrine and epinephrine in vitro. It lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis. RNLS has physiologically relevant catecholamine-oxidizing activity. (PMID:15841207 ) This antibody is specific to RNLS.