RFC3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RFC3 Polyclonal antibody (11814-1-AP)

• Featured Product
• KD/KO Validated

RFC3 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 11814-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, CoIP, ELISA

Synonyms

RF-C 38 kDa subunit

• 

  WB analysis of human liver using 11814-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 11814-1-AP (RFC3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 11814-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 11814-1-AP (RFC3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 11814-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11814-1-AP (RFC3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 11814-1-AP

  IP result of anti-RFC3 (IP:11814-1-AP, 4 ug; Detection:11814-1-AP 1:600) with HeLa cells lysate 1200 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U2OS using 11814-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using RFC3 antibody (11814-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U2OS using 11814-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using RFC3 antibody (11814-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), Beta Actin antibody (66009-1-Ig, Clone: 2D4H5, red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RFC3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human liver tissue, HeLa cells, human heart tissue
• Positive IP detected in: HeLa cells
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11814-1-AP targets RFC3 in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2269

  Product name: Recombinant human RFC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-356 aa of BC000149

  Sequence: MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF

• Full Name: replication factor C (activator 1) 3, 38kDa
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC000149
• Gene Symbol: RFC3
• Gene ID (NCBI): 5983
• RRID: AB_2178470
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P40938
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RFC3, also known as RFC38, is a 356 amino acid protein, which localizes in nucleus. Replication factor C (RFC) is a component of the eukaryotic DNA polymerase . In all eukaryotic cell cycles, it is essential for DNA duplication, DNA injury repair and checkpoint control. RFC consists of five subunits (RFC1-5). The interrelationships between RFC2, RFC3 and the c-MYC oncogene (transcription factor) can induce cell division and proliferation. RFC3 is associated with liver, breast, esophageal and ovarian cancer, and serves a critical role in cellular proliferation, invasion and metastasis. RFC3 exists two isoforms with molecular weight of 34 kDa and 38-40 kDa.

Publications

What published studies show

The RFC3 Polyclonal antibody (Cat# 11814-1-AP) has 5 total citations. These appear in Cell Reports (2), Acta Biochimica et Biophysica Sinica, Virology Journal, and Experimental & Therapeutic Medicine. Research fields span meiotic cell-cycle regulation, cancer genome evolution, gastric cancer progression, Zika virus replication restriction, and colorectal cancer proliferation and angiogenesis. Applications cited include WB and CoIP in human and mouse samples.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Rep; Cyclin N-Terminal Domain-Containing-1 Coordinates Meiotic Crossover Formation with Cell-Cycle Progression in a Cyclin-Independent Manner.; Authors - Stephen Gray
human	WB	Cell Rep; TRPS1 drives heterochromatic origin refiring and cancer genome evolution.; Authors - Jianguo Yang
human	WB	Acta Biochim Biophys Sin (Shanghai); FANCA facilitates G1/S cell cycle advancement, proliferation, migration and invasion in gastric cancer; Authors - Wei Wang
human	WB	Virol J; IRF2 inhibits ZIKV replication by promoting FAM111A expression to enhance the host restriction effect of RFC3.; Authors - Kai Ren ; KD Validated
human	CoIP	Exp Ther Med; RFC3 drives the proliferation, migration, invasion and angiogenesis of colorectal cancer cells by binding KIF14; Authors - Rong Yu