• Featured Product
  • KD/KO Validated

COP1 Polyclonal antibody

COP1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13542-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

COP1, hCOP1, RFWD2, RING finger protein 200, RNF200

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman heart tissue, mouse heart tissue
Positive IHC detected inhuman osteosarcoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13542-1-AP targets COP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4484

Product name: Recombinant human COP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-349 aa of BC039723

Sequence: SRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSENNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV

Predict reactive species
Full Name ring finger and WD repeat domain 2
Calculated Molecular Weight 731 aa, 80 kDa
Observed Molecular Weight 90 kDa
GenBank Accession NumberBC039723
Gene Symbol COP1
Gene ID (NCBI) 64326
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8NHY2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COP1 is also named as RFWD2, RNF200 and belongs to the COP1 family. It is a ubiquitin ligase that targets key regulators for degradation, and DET1 complexes with COP10 and DDB1, which is proposed to aid in COP1-mediated degradation (PMID:22705257). The endogenous COP1 is localized predominantly in the nucleus, but small amount may also be present in the cytosol. Within the nucleus, COP1 is present in both the nucleoplasm (NP) and the nuclear envelope (NE) fractions, although COP1 is more enriched in the nucleoplasm (PMID:12466024). Two of the COP1 isoforms identified by RNA-seq analysis predicted the size of two proteins detected by the antibody for COP1, a 75 kDa band, corresponding to the longer isoform, and a 50 kDa band corresponding to the shorter isoform. (PMID:24714719). It has been shown that COP1 forms dimerization through its coiled-coil region.

Publications

SpeciesApplicationTitle
humanWB

Cancer Lett

Primate-specific miR-944 activates p53-dependent tumor suppression in human colorectal cancers.

Authors - Yoon-Jin Kim
  • KD Validated
Loading...
||
New chat

Able

正在加载,请稍候...