RGS11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RGS11 Polyclonal antibody, PBS Only (26132-1-PBS)

• 

  WB analysis of HL-60 using 26132-1-AP (same clone as 26132-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 26132-1-AP (RGS11 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26132-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 26132-1-AP (same clone as 26132-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 26132-1-AP (RGS11 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26132-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 26132-1-AP (same clone as 26132-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 26132-1-AP (RGS11 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26132-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 26132-1-AP (same clone as 26132-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 26132-1-AP (RGS11 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26132-1-PBS in a different storage buffer formulation.

RGS11 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 26132-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

26132-1-PBS targets RGS11 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23562

  Product name: Recombinant human RGS11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-102 aa of BC153019

  Sequence: MERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQWLAQKFCVSEEEALHLGAVLVQHGYIYPLRDPRSLMLRPDETP

• Full Name: regulator of G-protein signaling 11
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC153019
• Gene Symbol: RGS11
• Gene ID (NCBI): 8786
• RRID: AB_2880394
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94810
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.