RHOB Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RHOB Recombinant monoclonal antibody, PBS Only (86663-3-PBS)

RHOB Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86663-3-PBS

Clone No.251662A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

ARH6, ARHB, h6, Rho cDNA clone 6, Rho-related GTP-binding protein RhoB

• 

  WB analysis using 86663-3-RR (same clone as 86663-3-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 86663-3-RR (RHOB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86663-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 86663-3-RR (same clone as 86663-3-PBS)

  WB result of RHOB antibody (86663-3-RR; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RHOB transfected HeLa cells. This data was developed using the same antibody clone with 86663-3-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 86663-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86663-3-RR against Human RHOB were performed. The affinity constant is 2.59 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

86663-3-PBS targets RHOB in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5593

  Product name: Recombinant human RHOB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-196 aa of BC066954

  Sequence: MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL

• Full Name: ras homolog gene family, member B
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22-26 kDa
• GenBank Accession Number: BC066954
• Gene Symbol: RHOB
• Gene ID (NCBI): 388
• RRID: AB_3745038
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P62745
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Rho-related GTP-binding protein RhoB (RHOB) is also named ARH6, ARHB and Rho cDNA clone 6 (h6). RhoB was the first member of the Rho family to be implicated in endosomal trafficking. One study showed that RhoB localizes and activates its downstream target, serine/threonine kinase (PRK1), on endosomes, and acts through this signaling pathway to disrupt the trafficking of internalized EGF receptor from endosomes to a prelysosomal compartment (PMID: 29385717). RhoB is known to be part of the immediate early genetic response to epidermal growth factor, transforming growth factor β, Src activation, or genotoxic stress (PMID:9545335, PMID: 10679283). RhoB was shown to have potential implications for EGF signaling by targeting the activated EGF receptors to the lysosome, which represents an "off-switch" for mitogenic signals (PMID: 1050858). RhoB was also demonstrated to exert a negative regulatory influence on TGF-β-induced transcriptional activation (PMID:9545335). The activity of the RhoB promoter was stimulated by genotoxic treatments indicating its role in the cellular response to DNA damage (PMID:9388198).