Use Able AI chat for product recommendations
  • KD/KO Validated

RHOB Recombinant monoclonal antibody

RHOB Uni-rAb® Recombinant Antibody for WB, ELISA

Cat No. 86663-3-RR
Clone No.251662A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

ARH6, ARHB, h6, Rho cDNA clone 6, Rho-related GTP-binding protein RhoB

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, HeLa cells, rat brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86663-3-RR targets RHOB in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5593

Product name: Recombinant human RHOB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-196 aa of BC066954

Sequence: MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL

Predict reactive species
Full Name ras homolog gene family, member B
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 22-26 kDa
GenBank Accession NumberBC066954
Gene Symbol RHOB
Gene ID (NCBI) 388
RRIDAB_3745038
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP62745
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rho-related GTP-binding protein RhoB (RHOB) is also named ARH6, ARHB and Rho cDNA clone 6 (h6). RhoB was the first member of the Rho family to be implicated in endosomal trafficking. One study showed that RhoB localizes and activates its downstream target, serine/threonine kinase (PRK1), on endosomes, and acts through this signaling pathway to disrupt the trafficking of internalized EGF receptor from endosomes to a prelysosomal compartment (PMID: 29385717). RhoB is known to be part of the immediate early genetic response to epidermal growth factor, transforming growth factor β, Src activation, or genotoxic stress (PMID:9545335, PMID: 10679283). RhoB was shown to have potential implications for EGF signaling by targeting the activated EGF receptors to the lysosome, which represents an "off-switch" for mitogenic signals (PMID: 1050858). RhoB was also demonstrated to exert a negative regulatory influence on TGF-β-induced transcriptional activation (PMID:9545335). The activity of the RhoB promoter was stimulated by genotoxic treatments indicating its role in the cellular response to DNA damage (PMID:9388198).

Protocols

Product Specific Protocols
WB protocol for RHOB antibody 86663-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...