MIRO2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68469-1-Ig (same clone as 68469-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68469-1-Ig (RHOT2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68469-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68469-1-Ig (same clone as 68469-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68469-1-Ig (RHOT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68469-1-PBS in a different storage buffer formulation.

MIRO2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68469-1-PBS

Clone No.1A3C2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

RHOT2, 1A3C2, ARHT2, C16orf39, EC:3.6.5.-

---

Product Information

68469-1-PBS targets MIRO2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29690

  Product name: Recombinant human RHOT2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 388-548 aa of BC014942

  Sequence: LCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRL

• Full Name: ras homolog gene family, member T2
• Calculated Molecular Weight: 68 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC014942
• Gene Symbol: RHOT2
• Gene ID (NCBI): 89941
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8IXI1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RHOT2 (Mitochondrial Rho GTPase 2) is also named as MIRO-2, hMiro-2, ARHT2, C16orf39 and Ras homolog gene family member T2. RHOT2 belongs to the mitochondrial Rho GTPase family. RHOT2 gene encodes a member of Rho family of GTPase, which are localized to the outer membrane of mitochondria (PMID: 22078885).