RIAM Monoclonal antibody, PBS Only

RIAM Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 67143-1-PBS
Clone No.2F8A2

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse

Applications

WB, IHC, IF-P, Indirect ELISA

APBB1 interacting protein 1, APBB1IP, APBB1IP,RIAM, INAG1, PREL 1, PREL1, Proline rich EVH1 ligand 1, Proline rich protein 73, RARP 1, RARP1, RIAM, RIAM,APBB1IP

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67143-1-PBS targets RIAM in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human, Mouse samples.

Tested Reactivity Human, Mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4602

Product name: Recombinant human RIAM,APBB1IP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-172 aa of BC035636

Sequence: MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPPPPEPLSQVSMWDQRWQDHQPLLPITDVP

Predict reactive species
Full Name amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein
Calculated Molecular Weight 666 aa, 73 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC035636
Gene Symbol RIAM
Gene ID (NCBI) 54518
RRIDAB_2882442
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ7Z5R6
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

APBB1IP gene encodes a Rap1-GTP-interacting adapter molecule (RIAM) which is an important protein in Rap1-mediated integrin activation and adhesion. Rap1 is a small GTPase frequently activated in tumors such as melanoma and prostate cancer. RIAM is widely expressed with high expression in thymus, spleen, lymph node, bone marrow and peripheral leukocytes. RIAM may function in the signal transduction from Ras activation to actin cytoskeletal remodeling. The observed molecular weight of RIAM is about 100 kDa.

Loading...
||
New chat Able
正在加载,请稍候...