RIAM Monoclonal antibody

RIAM Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67143-1-Ig
Clone No.2F8A2

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse

Applications

WB, IHC, IF-P, ELISA

APBB1 interacting protein 1, APBB1IP, APBB1IP,RIAM, INAG1, PREL 1, PREL1, Proline rich EVH1 ligand 1, Proline rich protein 73, RARP 1, RARP1, RIAM, RIAM,APBB1IP

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTHP-1 cells, HL-60 cells, Raji cells, mouse brain tissue, Jurkat cells, Ramos cells, Dauli cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67143-1-Ig targets RIAM in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse samples.

Tested Reactivity Human, Mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4602

Product name: Recombinant human RIAM,APBB1IP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-172 aa of BC035636

Sequence: MGESSEDIDQMFSTLLGEMDLLTQSLGVDTLPPPDPNPPRAEFNYSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATGISQYEDDLPPPPADPVLDLPLPPPPPEPLSQVSMWDQRWQDHQPLLPITDVP

Predict reactive species
Full Name amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein
Calculated Molecular Weight 666 aa, 73 kDa
Observed Molecular Weight 100 kDa
GenBank Accession NumberBC035636
Gene Symbol RIAM
Gene ID (NCBI) 54518
RRIDAB_2882442
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ7Z5R6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

APBB1IP gene encodes a Rap1-GTP-interacting adapter molecule (RIAM) which is an important protein in Rap1-mediated integrin activation and adhesion. Rap1 is a small GTPase frequently activated in tumors such as melanoma and prostate cancer. RIAM is widely expressed with high expression in thymus, spleen, lymph node, bone marrow and peripheral leukocytes. RIAM may function in the signal transduction from Ras activation to actin cytoskeletal remodeling. The observed molecular weight of RIAM is about 100 kDa.

Protocols

Product Specific Protocols
WB protocol for RIAM antibody 67143-1-IgDownload protocol
IHC protocol for RIAM antibody 67143-1-IgDownload protocol
IF protocol for RIAM antibody 67143-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...