RIF1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RIF1 Polyclonal antibody, PBS Only (30119-1-PBS)

• 

  WB analysis using 30119-1-AP (same clone as 30119-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30119-1-AP (RIF1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30119-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 30119-1-AP (same clone as 30119-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 30119-1-AP (RIF1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30119-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 30119-1-AP (same clone as 30119-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 30119-1-AP (RIF1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30119-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 30119-1-AP (same clone as 30119-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 30119-1-AP (RIF1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30119-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 30119-1-AP (same clone as 30119-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RIF1 antibody (30119-1-AP) at dilution of 1:1200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 30119-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 30119-1-AP (same clone as 30119-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using RIF1 antibody (30119-1-AP) at dilution of 1:1200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 30119-1-PBS in a different storage buffer formulation.

RIF1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30119-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

30119-1-PBS targets RIF1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32422

  Product name: Recombinant human RIF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2277-2472 aa of NM_001177663.1

  Sequence: SEMAKESIPCPTESVYPPLVNCVAPVDIILPQITSNMWARGLGQLIRAKNIKTIGDLSTLTASEIKTLPIRSPKVSNVKKALRIYHEQQVKTRGLEEIPVFDISEKTVNGIENKSLSPDEERLVSDIIDPVALEIPLSKNLLAQISALALQLDSEDLHNYSGSQLFEMHEKLSCMANSVIKNLQSRWRSPSHENSI

• Full Name: RAP1 interacting factor homolog (yeast)
• Calculated Molecular Weight: 274 kDa
• Observed Molecular Weight: 300 kDa
• GenBank Accession Number: NM_001177663.1
• Gene Symbol: RIF1
• Gene ID (NCBI): 55183
• RRID: AB_2935516
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5UIP0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RIF1 (Rap1-interacting factor 1) is a multifunctional chromosome stability protein implicated in controlling DNA replication and repair. Human RIF1 can interact with protein phosphatase 1 (PP1) and the interaction is crucial for controlling DNA replication by limiting phosphorylation of the MCM complex (PMID: 28077461). RIF1 also acts with PP1 to protect nascent DNA from overdegradation at stalled replication forks (PMID: 31141682). RIF1 promotes non-homologous end joining (NHEJ) in double strand break (DSB) repair (PMID: 30443189). Research studies show that RIF1 is overexpressed in breast cancer tissues and is upgraded in NSCLC tissues (PMID: 30237512).