RIM1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RIM1 Polyclonal antibody, PBS Only (24576-1-PBS)

• 

  WB analysis using 24576-1-AP (same clone as 24576-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24576-1-AP (RIM1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24576-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 24576-1-AP (same clone as 24576-1-PBS)

  IP result of anti-RIM1 (IP:24576-1-AP, 4ug; Detection:24576-1-AP 1:1000) with mouse brain tissue lysate 4000ug. This data was developed using the same antibody clone with 24576-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 24576-1-AP (same clone as 24576-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24576-1-AP (RIM1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24576-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 24576-1-AP (same clone as 24576-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24576-1-AP (RIM1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24576-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RIM1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 24576-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

24576-1-PBS targets RIM1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20161

  Product name: Recombinant human RIMS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 923-1039 aa of BC152435

  Sequence: KSTTLTVPEQQRTTHHRSRSVSPHRGNDQGKPRSRLPNVPLQRSLDEIHPTRRSRSPTRHHDASRSPVDHRTRDVDSQYLSEQDSELLMLPRAKRGRSAECLHTTR

• Full Name: regulating synaptic membrane exocytosis 1
• Calculated Molecular Weight: 1692 aa, 189 kDa
• Observed Molecular Weight: 189 kDa
• GenBank Accession Number: BC152435
• Gene Symbol: RIMS1
• Gene ID (NCBI): 22999
• RRID: AB_2879618
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86UR5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RIMS1 is a RAS gene superfamily member that regulates synaptic vesicle exocytosis. RIMS1 also plays a role in the regulation of voltage-gated calcium channels during neurotransmitter and insulin release. Mutations in RIMS1 have suggested a role cognition and have been identified as the cause of cone-rod dystrophy type 7.