RIT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RIT1 Polyclonal antibody, PBS Only (26977-1-PBS)

• 

  WB analysis using 26977-1-AP (same clone as 26977-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26977-1-AP (RIT1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26977-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 26977-1-AP (same clone as 26977-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using RIT1 antibody (26977-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 26977-1-PBS in a different storage buffer formulation.

RIT1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 26977-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

GTP binding protein Rit1, Ras like protein expressed in many tissues, Ras like without CAAX 1, Ras like without CAAX protein 1, RIBB

---

Product Information

26977-1-PBS targets RIT1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25636

  Product name: Recombinant human RIT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 140-219 aa of BC104186

  Sequence: QLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT

• Full Name: Ras-like without CAAX 1
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC104186
• Gene Symbol: RIT1
• Gene ID (NCBI): 6016
• RRID: AB_3669578
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92963
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RIT1 (Ras-like without CAAX protein 1) is also named as RIBB, ROC1 and GTP-binding protein Rit1. RIT1 serves as a regulatory factor for neuronal cell proliferation, survival, and differentiation (PMID: 28007959). Rit1 mediates oxidative stress resistance, contributing to cell survival via the p38 MAPK signaling pathway (PMID: 21737674). As a small G protein of Ras family, RIT1 plays a critical role in various tumors (such as hepatocellular carcinoma, HCC) (PMID: 38017479). It is worth noting that RIT1 is frequently amplified in various human cancers including HCC, lung adenocarcinoma, cholangiocarcinoma, uterine carcinosarcoma, breast cancer, and ovarian cancer (PMID: 38017479).