RIT1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85347-1-RR (same clone as 85347-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85347-1-RR (RIT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85347-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 85347-1-RR (same clone as 85347-1-PBS)

  Mouse kidney tissue was subjected to SDS PAGE followed by western blot with 85347-1-RR (RIT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85347-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85347-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85347-1-RR against Human RIT1 were performed. The affinity constant is 0.505 nM.

RIT1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85347-1-PBS

Clone No.242593E4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

RIBB, Ras like without CAAX protein 1, Ras like without CAAX 1, Ras like protein expressed in many tissues, GTP binding protein Rit1

---

Product Information

85347-1-PBS targets RIT1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25636

  Product name: Recombinant human RIT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 140-219 aa of BC104186

  Sequence: QLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT

• Full Name: Ras-like without CAAX 1
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC104186
• Gene Symbol: RIT1
• Gene ID (NCBI): 6016
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q92963
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RIT1 (Ras-like without CAAX protein 1) is also named as RIBB, ROC1 and GTP-binding protein Rit1. RIT1 serves as a regulatory factor for neuronal cell proliferation, survival, and differentiation (PMID: 28007959). Rit1 mediates oxidative stress resistance, contributing to cell survival via the p38 MAPK signaling pathway (PMID: 21737674). As a small G protein of Ras family, RIT1 plays a critical role in various tumors (such as hepatocellular carcinoma, HCC) (PMID: 38017479). It is worth noting that RIT1 is frequently amplified in various human cancers including HCC, lung adenocarcinoma, cholangiocarcinoma, uterine carcinosarcoma, breast cancer, and ovarian cancer (PMID: 38017479).