RIT1 Recombinant monoclonal antibody, PBS Only

RIT1 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 85347-1-PBS
Clone No.242593E4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

RIBB, Ras like without CAAX protein 1, Ras like without CAAX 1, Ras like protein expressed in many tissues, GTP binding protein Rit1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85347-1-PBS targets RIT1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25636

Product name: Recombinant human RIT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 140-219 aa of BC104186

Sequence: QLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT

Predict reactive species
Full Name Ras-like without CAAX 1
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 25-28 kDa
GenBank Accession NumberBC104186
Gene Symbol RIT1
Gene ID (NCBI) 6016
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92963
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RIT1 (Ras-like without CAAX protein 1) is also named as RIBB, ROC1 and GTP-binding protein Rit1. RIT1 serves as a regulatory factor for neuronal cell proliferation, survival, and differentiation (PMID: 28007959). Rit1 mediates oxidative stress resistance, contributing to cell survival via the p38 MAPK signaling pathway (PMID: 21737674). As a small G protein of Ras family, RIT1 plays a critical role in various tumors (such as hepatocellular carcinoma, HCC) (PMID: 38017479). It is worth noting that RIT1 is frequently amplified in various human cancers including HCC, lung adenocarcinoma, cholangiocarcinoma, uterine carcinosarcoma, breast cancer, and ovarian cancer (PMID: 38017479).

Loading...
||
New chat Able
正在加载,请稍候...