RIT1 Recombinant monoclonal antibody

RIT1 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 85347-1-RR
Clone No.242593E4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

RIBB, Ras like without CAAX protein 1, Ras like without CAAX 1, Ras like protein expressed in many tissues, GTP binding protein Rit1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, mouse kidney tissue, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85347-1-RR targets RIT1 in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25636

Product name: Recombinant human RIT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 140-219 aa of BC104186

Sequence: QLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT

Predict reactive species
Full Name Ras-like without CAAX 1
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 25-28 kDa
GenBank Accession NumberBC104186
Gene Symbol RIT1
Gene ID (NCBI) 6016
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92963
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RIT1 (Ras-like without CAAX protein 1) is also named as RIBB, ROC1 and GTP-binding protein Rit1. RIT1 serves as a regulatory factor for neuronal cell proliferation, survival, and differentiation (PMID: 28007959). Rit1 mediates oxidative stress resistance, contributing to cell survival via the p38 MAPK signaling pathway (PMID: 21737674). As a small G protein of Ras family, RIT1 plays a critical role in various tumors (such as hepatocellular carcinoma, HCC) (PMID: 38017479). It is worth noting that RIT1 is frequently amplified in various human cancers including HCC, lung adenocarcinoma, cholangiocarcinoma, uterine carcinosarcoma, breast cancer, and ovarian cancer (PMID: 38017479).

Protocols

Product Specific Protocols
WB protocol for RIT1 antibody 85347-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...