RNASE1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RNASE1 Polyclonal antibody, PBS Only (15892-1-PBS)

• 

  WB analysis using 15892-1-AP (same clone as 15892-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15892-1-AP (RNASE1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15892-1-PBS in a different storage buffer formulation.

RNASE1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15892-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

15892-1-PBS targets RNASE1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8679

  Product name: Recombinant human RNASE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-156 aa of BC005324

  Sequence: PSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST

• Full Name: ribonuclease, RNase A family, 1 (pancreatic)
• Calculated Molecular Weight: 156 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC005324
• Gene Symbol: RNASE1
• Gene ID (NCBI): 6035
• RRID: AB_3085473
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07998
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.