Filter: AllWB

WB analysis of human urine using 88054-1-RR (same clone as 88054-1-PBS)
human urine sample were subjected to SDS PAGE followed by western blot with 88054-1-RR (RNASE2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88054-1-PBS in a different storage buffer formulation.

RNASE2 Recombinant monoclonal antibody, PBS Only

Name: RNASE2 Recombinant monoclonal antibody, PBS Only
Brand: Proteintech
SKU: 88054-1-PBS

RNASE2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 88054-1-PBS

Clone No.260304C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EC:4.6.1.18, EDN, Eosinophil-derived neurotoxin, Non-secretory ribonuclease, RNase 2

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

88054-1-PBS targets RNASE2 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag28325 Product name: Recombinant human RNASE2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 31-161 aa of BC093678 Sequence: QFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII Predict reactive species
Full Name	ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
Calculated Molecular Weight	161 aa, 18 kDa
Observed Molecular Weight	18 kDa
GenBank Accession Number	BC093678
Gene Symbol	RNASE2
Gene ID (NCBI)	6036
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P10153
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™