Use Able AI chat for product recommendations

RNASE2/EDN Recombinant monoclonal antibody

RNASE2/EDN Uni-rAb® Recombinant Antibody for WB, ELISA

Cat No. 88054-1-RR
Clone No.260304C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

RNASE2, EC:4.6.1.18, EDN, Eosinophil-derived neurotoxin, Non-secretory ribonuclease

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman urine sample

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

88054-1-RR targets RNASE2/EDN in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag28325

Product name: Recombinant human RNASE2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 31-161 aa of BC093678

Sequence: QFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII

Predict reactive species
Full Name ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
Calculated Molecular Weight 161 aa, 18 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC093678
Gene Symbol RNASE2
Gene ID (NCBI) 6036
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10153
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RNASE2, also known as eosinophil-derived neurotoxin (EDN), is a member of the RNase A superfamily and is predominantly expressed in eosinophilic leukocytes, where it is stored in large quantities within specific cytoplasmic granules. Structurally, RNASE2 possesses a catalytic domain that confers ribonuclease activity, which enables its primary role in the host immune response against viral infections by directly degrading viral RNA, thereby inhibiting viral replication. Upon release from activated eosinophils, RNASE2 can signal through pattern recognition receptors such as Toll-like receptor 2 (TLR2) to activate dendritic cells and promote T-helper type 2 (Th2) immune responses. Elevated levels of RNASE2 are found in various inflammatory conditions, including asthma, allergic rhinitis, and parasitic infections, making it a key biomarker for eosinophil activation. Beyond its roles in immunity and inflammation, RNASE2 also exhibits neurotoxic activity, and has been implicated in wound healing and tissue remodeling processes.

Protocols

Product Specific Protocols
WB protocol for RNASE2/EDN antibody 88054-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...