RNASE6 Polyclonal antibody

• 

  IHC staining of human liver using 16425-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16425-1-AP (RNASE6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 16425-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 16425-1-AP (RNASE6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 16425-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 16425-1-AP (RNASE6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 16425-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16425-1-AP (RNASE6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of THP-1 using 16425-1-AP

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using RNASE6 antibody (16425-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

RNASE6 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 16425-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

RNS6, RNase K6, EC:3.1.27.-

---

Tested Applications

• Positive IHC detected in: human liver tissue, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16425-1-AP targets RNASE6 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9667

  Product name: Recombinant human RNASE6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-150 aa of BC020848

  Sequence: WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL

• Full Name: ribonuclease, RNase A family, k6
• Calculated Molecular Weight: 150 aa, 17 kDa
• GenBank Accession Number: BC020848
• Gene Symbol: RNASE6
• Gene ID (NCBI): 6039
• RRID: AB_3669243
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q93091
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rnase6, a protein belonging to the superfamily, is considered the only vertebrate specific enzyme known to have a wide range of physiological functions, including digestion, cytotoxicity, angiogenesis, male reproduction, and host defense. Rnase6 expression was upregulated in the peripheral blood and plaque tissues of AS patients (PMID: 34395402).