RNF113A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RNF113A Polyclonal antibody, PBS Only (27018-1-PBS)

• 

  WB analysis using 27018-1-AP (same clone as 27018-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27018-1-AP (RNF113A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27018-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 27018-1-AP (same clone as 27018-1-PBS)

  WB result of RNF113A antibody (27018-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RNF113A transfected MCF-7 cells. This data was developed using the same antibody clone with 27018-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 27018-1-AP (same clone as 27018-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 27018-1-AP (RNF113A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27018-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RNF113A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27018-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

ZNF183, EC:2.3.2.27, E3 ubiquitin-protein ligase RNF113A, Cwc24 homolog

---

Product Information

27018-1-PBS targets RNF113A in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25313

  Product name: Recombinant human RNF113A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 41-100 aa of BC000832

  Sequence: GESGSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVY

• Full Name: ring finger protein 113A
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC000832
• Gene Symbol: RNF113A
• Gene ID (NCBI): 7737
• RRID: AB_2880724
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15541
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.