RNF139 Recombinant monoclonal antibody

RNF139 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83755-2-RR
Clone No.240481G6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

240481G6, E3 ubiquitin-protein ligase RNF139, EC:2.3.2.27, HRCA1, RCA1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU2OS cells, U-87 MG cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83755-2-RR targets RNF139 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag21530

Product name: Recombinant human RNF139 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 589-664 aa of BC064636

Sequence: VYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD

Predict reactive species
Full Name ring finger protein 139
Calculated Molecular Weight 664 aa, 76 kDa
Observed Molecular Weight76 kDa
GenBank Accession NumberBC064636
Gene Symbol RNF139
Gene ID (NCBI) 11236
RRIDAB_3671352
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ8WU17
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The RNF139 gene (ring-finger protein 139), also known as TRC8 (translocation in renal carcinoma from chromosome 8), was first identified from a family with 3;8 chromosomal translocation and hereditary renal cell carcinoma and thyroid cancer (PMID:22689053). RNF139 encodes an endoplasmic reticulum (ER) protein with 10 transmembrane segments that contain a sterol-sensing domain and a RING finger motif encoding an E3 ubiquitin ligase (PMID: 19706601). Northern blot and dot blot show that RNF139 is highly expressed in the testis, placenta, and adrenal gland and is expressed at lower levels in the heart, brain, liver, skeletal muscle, and pancreas (PMID: 9689122). It is reported that TRC8 suppresses tumorigenesis by targeting heme oxygenase-1 (HO-1), an antioxidant enzyme highly expressed in various cancers, for ubiquitination and degradation (PMID:22689053). TRC8 is also involved in cholesterol and fatty acid biosynthesis that are transcriptionally regulated by the sterol response element binding proteins (SREBPs) (PMID:17016439). Acetylation, phosphorylation, and autoubiquitination are common post-translational modifications of FNF139 protein.

Protocols

Product Specific Protocols
FC protocol for RNF139 antibody 83755-2-RRDownload protocol
WB protocol for RNF139 antibody 83755-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...