RNF170 Polyclonal antibody

• 

  WB analysis of human placenta using 21024-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 21024-1-AP (RNF170 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 21024-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 21024-1-AP (RNF170 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 21024-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 21024-1-AP (RNF170 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human kidney using 21024-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 21024-1-AP (RNF170 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 21024-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 21024-1-AP (RNF170 antibody) at dilution of 1:50 (under 40x lens).

RNF170 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21024-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

ring finger protein 170, RNF170

---

Tested Applications

• Positive WB detected in: human placenta tissue
• Positive IHC detected in: human breast cancer tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21024-1-AP targets RNF170 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15288

  Product name: Recombinant human RNF170 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-132 aa of BC032393

  Sequence: MAKYQGEVQSLKLDDDSVIEGVSDQVLVAVVVSFALIATLVYALFRNVHQNIHPENQELVRVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSWLGAISCPICRQT

• Full Name: ring finger protein 170
• Calculated Molecular Weight: 258 aa, 30 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC032393
• Gene Symbol: RNF170
• Gene ID (NCBI): 81790
• RRID: AB_10733119
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96K19
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RNF170 is an E3 ubiquitin ligase that resides in the endoplasmic reticulum (ER) membrane and mediates ubiquitination and processing of inositol 1,4,5-trisphosphate (IP3) receptors by the ER-associated protein degradation (ERAD) pathway. It has 6 isoforms produced by Alternative splicing with the molecular weight of 30 kDa, 27 kDa, 22 kDa, 20 kDa, 19 kDa, and 13 kDa.