RNF216 Recombinant monoclonal antibody, PBS Only (Capture)

RNF216 Uni-rAb® Recombinant Antibody for WB, FC (Intra), IP, Cytometric bead array, Indirect ELISA
Cat No. 83658-2-PBS
Clone No.240489G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), IP, Cytometric bead array, Indirect ELISA

240489G2, E3 ubiquitin-protein ligase RNF216, EC:2.3.2.27, RING finger protein 216, RING-type E3 ubiquitin transferase RNF216

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83658-2-PBS targets RNF216 as part of a matched antibody pair:

MP00643-1: 83658-2-PBS capture and 83658-5-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0238

Product name: Recombinant human RNF216 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 73-276 aa of BC000787

Sequence: KRRHCRSYDRRALLPAVQQEQEFYEQKIKEMAEHEDFLLALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLFCKECLIRYAQEAVFGSGKLELSCMEGSCTCSFPTSELEKVLPQTILYKYYERKAEEEVAAAYADELVRCPSCSFPALLDSDVKRFSCPNPHCRKETCRKCQGLWKEHNGLTCEELAEKDDIKYRTS

Predict reactive species
Full Name ring finger protein 216
Calculated Molecular Weight 48 kDa
Observed Molecular Weight57 kDa, 90-99 kDa, 106~130 kDa
GenBank Accession NumberBC000787
Gene Symbol RNF216
Gene ID (NCBI) 54476
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NWF9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RNF216/TRIAD3 is an RBR (RING-between-RING) E3 ligase that encodes for multiple isoforms that include TRIAD3A, TRIAD3B, TRIAD3C and TRIAD3D/E. RNF216 is a broadly expressed RBR E3 ligase, and loss-of-function mutations in RNF216 are linked to the neurode-generative conditions Gordon-Holmes syndrome (GHS) and Huntington-like disorders (PMID: 34998453, 35620441). RNF216 has three different molecular weights, 99 kDa, 106 kDa and 57 kDa, respectively. Western analysis detected the ~130 kDa band as indicated in literature (PMID: 21270397).

Loading...
||
New chat Able
正在加载,请稍候...