RNF5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RNF5 Polyclonal antibody, PBS Only (20105-1-PBS)

• 

  WB analysis using 20105-1-AP (same clone as 20105-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20105-1-AP (RNF5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20105-1-PBS in a different storage buffer formulation.

RNF5 Polyclonal Antibody for WB, ELISA

Cat No. 20105-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

G16, NG2, Protein G16, RING5, RMA1

---

Product Information

20105-1-PBS targets RNF5 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13737

  Product name: Recombinant human RNF5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-125 aa of BC004155

  Sequence: MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFG

• Full Name: ring finger protein 5
• Calculated Molecular Weight: 180 aa, 20 kDa
• Observed Molecular Weight: 15-50 kDa
• GenBank Accession Number: BC004155
• Gene Symbol: RNF5
• Gene ID (NCBI): 6048
• RRID: AB_3669323
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99942
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The RING (really interesting new gene) finger protein 5 (RNF5) is an ER-associated E3 ubiquitin ligase involved in ER-associated degradation (ERAD) for misfolded proteins.