RNGTT Recombinant monoclonal antibody, PBS Only

• 

  IHC staining of human placenta using 83974-4-RR (same clone as 83974-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 83974-4-RR (RNGTT antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83974-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 83974-4-RR (same clone as 83974-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 83974-4-RR (RNGTT antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83974-4-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 83974-4-RR (same clone as 83974-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using RNGTT antibody (83974-4-RR, Clone: 240927H2 ) at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83974-4-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 83974-4-RR (same clone as 83974-4-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug RNGTT Recombinant antibody (83974-4-RR, Clone:240927H2) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 83974-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83974-4-PBS

  Biolayer interferometry (BLl) kinetic assay of 83974-4-PBS against Human RNGTT was performed. The affinity constant is 0.319 nM.

• 

  Affinity and Kinetic Characterization of 83974-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83974-4-RR against Human RNGTT were performed. The affinity constant is below 1 pM.

RNGTT Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 83974-4-PBS

Clone No.240927H2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

240927H2, CAP1A, GTase, GTP  RNA guanylyltransferase, GTP--RNA guanylyltransferase

---

Product Information

83974-4-PBS targets RNGTT in IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3105

  Product name: Recombinant human RNGTT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 242-598 aa of BC019954

  Sequence: TQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKLLEGNFAKEVSHEMDGLIFQPTGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFEFIDRCTAASQGQKRKHHLDPDTELMPPPPPKRPHPLT

• Full Name: RNA guanylyltransferase and 5'-phosphatase
• Calculated Molecular Weight: 597 aa, 69 kDa
• GenBank Accession Number: BC019954
• Gene Symbol: RNGTT
• Gene ID (NCBI): 8732
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O60942
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RNGTT(mRNA-capping enzyme) is also named as HCAP1, HCE, CAP1A. In the N-terminal section it belongs to the non-receptor class of the protein-tyrosine phosphatase family and in the C-terminal section it belongs to the eukaryotic GTase family. It is a bifunctional 597-amino acid protein with RNA triphosphatase and RNA guanylyltransferase activities(PMID:9545288). It has 4 isoforms produced by alternative splicing.