RNGTT Recombinant monoclonal antibody

• 

  IHC staining of human placenta using 83974-4-RR

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 83974-4-RR (RNGTT antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 83974-4-RR

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 83974-4-RR (RNGTT antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 83974-4-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using RNGTT antibody (83974-4-RR, Clone: 240927H2 ) at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  FC experiment of HepG2 using 83974-4-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug RNGTT Recombinant antibody (83974-4-RR, Clone:240927H2) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set.

• 

  Affinity and Kinetic Characterization of 83974-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83974-4-RR against Human RNGTT were performed. The affinity constant is below 1 pM.

RNGTT Uni-rAb^® Recombinant Antibody for IHC, IF/ICC, FC (Intra), ELISA

Cat No. 83974-4-RR

Clone No.240927H2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, FC (Intra), ELISA

Synonyms

hCAP, GTP--RNA guanylyltransferase, GTP  RNA guanylyltransferase, GTase, CAP1A

---

Tested Applications

• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83974-4-RR targets RNGTT in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3105

  Product name: Recombinant human RNGTT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 242-598 aa of BC019954

  Sequence: TQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIKLLDLKPYKVSWKADGTRYMMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYLIYDIIKFNSQPVGDCDFNVRLQCIEREIISPRHEKMKTGLIDKTQEPFSVRNKPFFDICTSRKLLEGNFAKEVSHEMDGLIFQPTGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEGLLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFEFIDRCTAASQGQKRKHHLDPDTELMPPPPPKRPHPLT

• Full Name: RNA guanylyltransferase and 5'-phosphatase
• Calculated Molecular Weight: 597 aa, 69 kDa
• GenBank Accession Number: BC019954
• Gene Symbol: RNGTT
• Gene ID (NCBI): 8732
• RRID: AB_3671550
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O60942
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RNGTT(mRNA-capping enzyme) is also named as HCAP1, HCE, CAP1A. In the N-terminal section it belongs to the non-receptor class of the protein-tyrosine phosphatase family and in the C-terminal section it belongs to the eukaryotic GTase family. It is a bifunctional 597-amino acid protein with RNA triphosphatase and RNA guanylyltransferase activities(PMID:9545288). It has 4 isoforms produced by alternative splicing.