RNH1 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 66028-1-Ig (same clone as 66028-1-PBS)

  HeLa, Jurkat, L02 cells were subjected to SDS PAGE followed by western blot with 66028-1-Ig (RNH1 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66028-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa cells using 66028-1-Ig (same clone as 66028-1-PBS)

  WB result of RNH1 antibody (66028-1-Ig, 1:4000) with si-control and si-RNH1 transfected HeLa cells. This data was developed using the same antibody clone with 66028-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66028-1-Ig (same clone as 66028-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66028-1-Ig (RNH1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66028-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66028-1-Ig (same clone as 66028-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66028-1-Ig (RNH1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66028-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 66028-1-Ig (same clone as 66028-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 66028-1-Ig (RNH1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66028-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RNH1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66028-1-PBS

Clone No.4A1C4

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Placental RNase inhibitor, PRI, RAI, Ribonuclease inhibitor, RNH, RNH1

---

Product Information

66028-1-PBS targets RNH1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18093

  Product name: Recombinant human RNH1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-214 aa of BC000677

  Sequence: MSLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLTGAGCGVLSSTLRTLPTLQELHLSDNLLGDAGLQLLCEGLLDPQCRLEKLQLEYCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVHVLCQGLKDSPCQLEALKLESCGVTSD

• Full Name: ribonuclease/angiogenin inhibitor 1
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC000677
• Gene Symbol: RNH1
• Gene ID (NCBI): 6050
• RRID: AB_11043338
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P13489
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ribonuclease/ angiogenin inhibitor (RNH, synonyms: RAI, MGC4569, MGC18200, MGC54054) is a protein that binds tightly to ribonucleases in cells and may be essential in the control of mRNA degradation and gene expression. The human RNH gene has been regionally localized to chromosome band 11p15 by in situ hybridization.