Tested Applications
| Positive WB detected in | HT-1080 cells, mouse brain tissue, HeLa cells, mouse lung tissue, MCF-7 cells, mouse liver tissue, L02 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21645-1-AP targets ROCK2(middle) in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16330 Product name: Recombinant human ROCK2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC111801 Sequence: MEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMNLEKQNAELRKERQDADGQMKELQDQ Predict reactive species |
| Full Name | Rho-associated, coiled-coil containing protein kinase 2 |
| Calculated Molecular Weight | 77 kDa, 161 kDa |
| Observed Molecular Weight | 161 kDa |
| GenBank Accession Number | BC111801 |
| Gene Symbol | ROCK2 |
| Gene ID (NCBI) | 9475 |
| RRID | AB_10858624 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75116 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ROCK2 is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. It is an isozyme of ROCK1, is a target for the small GTPase Rho. ROCK2 is localized in both cytoplasm and nucleus, and the nucleus-localized ROCK2 can target p300 for phosphorylation to regulate its acetyltransferase activity (PMID:16574662).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ROCK2(middle) antibody 21645-1-AP | Download protocol |
| IHC protocol for ROCK2(middle) antibody 21645-1-AP | Download protocol |
| IP protocol for ROCK2(middle) antibody 21645-1-AP | Download protocol |
| WB protocol for ROCK2(middle) antibody 21645-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-RhoA antibody (Cat# 21645-1-AP) has accumulated 42 citations across journals including Nature Communications, Molecular Cancer, ACS Nano, Cell Death & Disease, Journal of Ethnopharmacology, Aging Cell, and Oncotarget. Associated research fields span oncology (NSCLC, HCC, glioma, renal cell carcinoma, myeloma), neuroscience (cerebral ischemia, neuroinflammation, cognitive impairment), cardiovascular disease, fibrosis, bone biology, diabetes, and traditional Chinese medicine pharmacology.
| Species | Application | Title |
|---|---|---|
Mol Cancer Hsa_circ_0125356 promotes gemcitabine resistance by modulating WNT canonical and non-canonical pathways via miR-582-5p/FGF9 axis in non-small cell lung cancer | ||
Drug Resist Updat Endothelial SMAD1-MCAM axis facilitates sunitinib resistance and progression of clear cell renal cell carcinoma via LAMB1-ITGB1 signaling. | ||
Nat Commun In situ osteogenic activation of mesenchymal stem cells by the blood clot biomimetic mechanical microenvironment | ||
ACS Nano Graphene Oxide Induced Perturbation to Plasma Membrane and Cytoskeletal Meshwork Sensitize Cancer Cells to Chemotherapeutic Agents | ||
Cell Rep Med Functional matrix vesicle replacement partially restores chemo-mechanical coupling in the aged bone niche. | ||
Cell Death Dis Acquired temozolomide resistance in MGMTlow gliomas is associated with regulation of homologous recombination repair by ROCK2.
|
Reviews
What customers say
One customer rated this product 5 stars, reporting excellent performance in Western Blot at a 1:1000 dilution on HCT116 cells. The reviewer noted that the antibody "worked great on the first try," indicating reliable and consistent results without the need for troubleshooting or optimization. Overall, the feedback reflects high satisfaction with the product's performance out of the box.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Steven (Verified Customer) (04-23-2025) | Worked great on the first try.
|
