ROCK2 Monoclonal antibody, PBS Only

• 

  WB analysis using 66633-1-Ig (same clone as 66633-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66633-1-Ig (ROCK2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66633-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66633-1-Ig (same clone as 66633-1-PBS)

  WB result of ROCK2 antibody (66633-1-Ig; 1:100000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ROCK2 transfected HeLa cells. This data was developed using the same antibody clone with 66633-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66633-1-Ig (same clone as 66633-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66633-1-Ig (ROCK2 antibody) at dilution of 1:500 (under 10x lens). This data was developed using the same antibody clone with 66633-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66633-1-Ig (same clone as 66633-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66633-1-Ig (ROCK2 antibody) at dilution of 1:500 (under 40x lens). This data was developed using the same antibody clone with 66633-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ROCK2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66633-1-PBS

Clone No.1C7B8

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

1C7B8, EC:2.7.11.1, KIAA0619, p164 ROCK-2, Rho kinase 2

---

Product Information

66633-1-PBS targets ROCK2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16330

  Product name: Recombinant human ROCK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-180 aa of BC111801

  Sequence: MEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMNLEKQNAELRKERQDADGQMKELQDQ

• Full Name: Rho-associated, coiled-coil containing protein kinase 2
• Calculated Molecular Weight: 77 kDa, 161 kDa
• Observed Molecular Weight: 161 kDa
• GenBank Accession Number: BC111801
• Gene Symbol: ROCK2
• Gene ID (NCBI): 9475
• RRID: AB_2881992
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75116
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ROCK2 is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. It is an isozyme of ROCK1, is a target for the small GTPase Rho. ROCK2 is localized in both cytoplasm and nucleus, and the nucleus-localized ROCK2 can target p300 for phosphorylation to regulate its acetyltransferase activity (PMID:16574662).This antibody is specific to ROCK2.