ROCK2(middle) Monoclonal antibody

• Home
• Products
• Primary Antibodies
• ROCK2(middle) Monoclonal antibody (66633-1-Ig)

• Featured Product
• KD/KO Validated

ROCK2(middle) Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66633-1-Ig Copied!

Clone No. 1C7B8

Publications (16)

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

ROCK2, 1C7B8, EC:2.7.11.1, KIAA0619, p164 ROCK-2

• 

  WB analysis using 66633-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66633-1-Ig (ROCK2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 66633-1-Ig

  WB result of ROCK2 antibody (66633-1-Ig; 1:100000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ROCK2 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66633-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66633-1-Ig (ROCK2 antibody) at dilution of 1:500 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 66633-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66633-1-Ig (ROCK2 antibody) at dilution of 1:500 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ROCK2(middle) in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, MCF-7 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66633-1-Ig targets ROCK2(middle) in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16330

  Product name: Recombinant human ROCK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-180 aa of BC111801

  Sequence: MEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMNLEKQNAELRKERQDADGQMKELQDQ

• Full Name: Rho-associated, coiled-coil containing protein kinase 2
• Calculated Molecular Weight: 77 kDa, 161 kDa
• Observed Molecular Weight: 161 kDa
• GenBank Accession Number: BC111801
• Gene Symbol: ROCK2
• Gene ID (NCBI): 9475
• RRID: AB_2881992
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75116
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ROCK2 is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. It is an isozyme of ROCK1, is a target for the small GTPase Rho. ROCK2 is localized in both cytoplasm and nucleus, and the nucleus-localized ROCK2 can target p300 for phosphorylation to regulate its acetyltransferase activity (PMID:16574662).This antibody is specific to ROCK2.

Publications

What published studies show

The ROCK2(middle) Monoclonal antibody (1C7B8), catalog number 66633-1-Ig, has 16 citations spanning journals including Kidney International, Advanced Science, Cell Reports Medicine, International Journal of Biological Sciences, European Journal of Pharmacology, Development, and others. Research fields cover kidney disease, cancer metastasis, cardiovascular/hypertension, pulmonary pathology, reproductive biology, autophagy, stem cell biology, and DNA damage response, primarily using WB and IHC applications in human, mouse, and rat models.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Kidney Int; Non-canonical Wnt/calcium signaling is protective against podocyte injury and glomerulosclerosis; Authors - Dong Zhou
mouse	WB,IF	Adv Sci (Weinh); Microfilament-Myosin II Regulates the Differentiation of Multinucleated Cysts into Oocytes and Influences Oocyte Developmental Potential in Mice.; Authors - Rui Xu
human	WB	Cell Rep Med; Patient-derived kidney organoids recapitulate ADPKD and facilitate the identification of Rho pathway inhibitors as candidate therapeutics.; Authors - Liqiang Guo
human	WB	Int J Biol Sci; Poly (ADP-ribose) polymerase 1 (PARP1) inhibition promotes pulmonary metastasis of osteosarcoma by boosting ezrin phosphorylation.; Authors - Fangfei Li
human	IHC	Eur J Med Chem; Discovery of unglycosylated indolocarbazoles as ROCK2 isoform-selective inhibitors for the treatment of breast cancer metastasis; Authors - Jinhui Wang
rat	WB,IHC	Ecotoxicol Environ Saf; Fluoride-induced hypertension by regulating RhoA/ROCK pathway and phenotypic transformation of vascular smooth muscle cells: In vitro and in vivo evidence; Authors - Wenjing Yang