ROGDI Polyclonal antibody

• 

  WB analysis of human brain using 17047-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 17047-1-AP (ROGDI antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human kidney using 17047-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 17047-1-AP (ROGDI antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 17047-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17047-1-AP (ROGDI antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 17047-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 17047-1-AP (ROGDI antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 17047-1-AP

  IP result of anti-ROGDI (IP:17047-1-AP, 4ug; Detection:17047-1-AP 1:500) with mouse brain tissue lysate 4000ug.

• 

  IHC staining of human kidney using 17047-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 17047-1-AP (ROGDI antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human kidney using 17047-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 17047-1-AP (ROGDI antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human placenta using 17047-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 17047-1-AP (ROGDI antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human placenta using 17047-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 17047-1-AP (ROGDI antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human spleen using 17047-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 17047-1-AP (ROGDI antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human spleen using 17047-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen using 17047-1-AP (ROGDI antibody) at dilution of 1:100 (under 40x lens).

• Featured Product
• KD/KO Validated

ROGDI Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 17047-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IP, IF, IHC, ELISA

Synonyms

Protein rogdi homolog, ROGDI, rogdi homolog (Drosophila)

---

Tested Applications

• Positive WB detected in: human brain tissue, human kidney tissue, mouse brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human kidney tissue, human placenta tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 3 publications below

Product Information

17047-1-AP targets ROGDI in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, Drosophila
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10688

  Product name: Recombinant human ROGDI protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-287 aa of BC012901

  Sequence: MATVMAATAAERAVLEEEFRWLLHDEVHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLTLQGDALSQADVNLKMPRNNQLLHFAFREDKQWKLQQIQDARNHVSQAIYLLTSRDQSYQFKTGAEVLKLMDAVMLQLTRARNRLTTPATLTLPEIAASGLTRMFAPALPSDLLVNVYINLNKLCLTVYQLHALQPNSTKNFRPAGGAVLHSPGAMFEWGSQRLEVSHVHKVECVIPWLNDALVYFTVSLQLCQQLKDKISVFSSYWSYRPF

• Full Name: rogdi homolog (Drosophila)
• Calculated Molecular Weight: 287 aa, 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC012901
• Gene Symbol: ROGDI
• Gene ID (NCBI): 79641
• RRID: AB_2182328
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9GZN7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ROGDI encoded by the ROGDI gene, which encodes a leucine-zipper protein with high expression in the human spinal cord and brain, acts as a positive regulator of cell proliferation. Defections of ROGDI are the cause of Kohlschuetter-Toenz syndrome (KTZS)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Am J Hum Genet; Mutations in ROGDI Cause Kohlschütter-T?nz Syndrome.; Authors - Schossig Anna A
Drosophila	IF	Am J Hum Genet; A nonsense mutation in the human homolog of Drosophila rogdi causes Kohlschutter-Tonz syndrome.; Authors - Mory Adi A
rat	WB, IF	Sci Rep; The Kohlschütter-Tönz syndrome associated gene Rogdi encodes a novel presynaptic protein.; Authors - Donatus Riemann
human	WB	Cancer Biol Ther; Downregulation of a novel human gene, ROGDI, increases radiosensitivity in cervical cancer cells.; Authors - Yi-Fan Chen ; KD Validated
mouse	IHC	Sci Rep; The Rogdi knockout mouse is a model for Kohlschütter-Tönz syndrome; Authors - Alexandra Jimenez-Armijo