ROPN1B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ROPN1B Polyclonal antibody, PBS Only (34136-1-PBS)

ROPN1B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 34136-1-PBS Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Rhophilin-associated protein 1B, Ropporin-1B

• 

  WB analysis using 34136-1-AP (same clone as 34136-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 34136-1-AP (ROPN1B antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 34136-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat testis using 34136-1-AP (same clone as 34136-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 34136-1-AP (ROPN1B antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 34136-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ROPN1B in ?

Chat with Able

---

Product Information

34136-1-PBS targets ROPN1B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10787

  Product name: Recombinant human ROPN1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-120 aa of BC015413

  Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE

• Full Name: ropporin, rhophilin associated protein 1B
• Calculated Molecular Weight: 120 aa, 24 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC015413
• Gene Symbol: ROPN1B
• Gene ID (NCBI): 152015
• RRID: AB_3743160
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BZX4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ropporin-1B (ROPN1B), cancer-restricted antigen, is highly expressed and immunogenic, inducing humoral immunity in patients with advanced metastatic melanoma (PMID: 33918976). It is important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, it plays a role in PKA-dependent signaling processes required for spermatozoa capacitation (PMID: 23303679).