POLR1A Recombinant monoclonal antibody

POLR1A Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 85633-1-RR
Clone No.243082E3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

A190, DNA-directed RNA polymerase I largest subunit, DNA-directed RNA polymerase I subunit A, DNA-directed RNA polymerase I subunit RPA1, EC:2.7.7.6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, HepG2 cells, LNCaP cells, MCF-7 cells, NIH/3T3 cells, HSC-T6 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85633-1-RR targets POLR1A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14543

Product name: Recombinant human RPA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 295-574 aa of BC017115

Sequence: DDEDMQEERNPHREGARKTQEQDEEVGLGTEEDPSLPALLTQPRKPTHSQEPQGPEAMERRVQAVREIHPFIDDYQYDTEESLWCQVTVKLPLMKINFDMSSLVVSLAHGAVIYATKGITRCLLNETTNNKNEKELVLNTEGINLPELFKYAEVLDLRRLYSNDIHAIANTYGIEAALRVIEKEIKDVFAVYGIAVDPRHLSLVADYMCFEGVYKPLNRFGIRSNSSPLQQMTFETSFQFLKQATMLGSHDELRSPSACLVVGKVVRGGTGLFELKQPLR

Predict reactive species
Full Name polymerase (RNA) I polypeptide A, 194kDa
Calculated Molecular Weight 1720 aa, 195 kDa
Observed Molecular Weight190-195 kDa
GenBank Accession NumberBC017115
Gene Symbol POLR1A
Gene ID (NCBI) 25885
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95602
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

POLR1A, DNA-directed RNA polymerase I subunit RPA1, is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA. RNA polymerase I (Pol I) located in the nucleolus and transcribes class I genes, which code for large ribosomal RNA. Different subunits of the Pol I transcription are targets of various physiological stimuli, which suggests that multiple signaling pathways are involved in carrying out Pol I ranscription. Together with the second largest subunit, it is the catalytic core component of RNA polymerase I that synthesizes ribosomal RNA precursors.

Protocols

Product Specific Protocols
WB protocol for POLR1A antibody 85633-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...