POLR1A Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85633-1-RR (same clone as 85633-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85633-1-RR (POLR1A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85633-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85633-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85633-1-RR against Human POLR1A were performed. The affinity constant is below 1 pM.

POLR1A Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85633-1-PBS

Clone No.243082E3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

A190, DNA-directed RNA polymerase I largest subunit, DNA-directed RNA polymerase I subunit A, DNA-directed RNA polymerase I subunit RPA1, EC:2.7.7.6

---

Product Information

85633-1-PBS targets POLR1A in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14543

  Product name: Recombinant human RPA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 295-574 aa of BC017115

  Sequence: DDEDMQEERNPHREGARKTQEQDEEVGLGTEEDPSLPALLTQPRKPTHSQEPQGPEAMERRVQAVREIHPFIDDYQYDTEESLWCQVTVKLPLMKINFDMSSLVVSLAHGAVIYATKGITRCLLNETTNNKNEKELVLNTEGINLPELFKYAEVLDLRRLYSNDIHAIANTYGIEAALRVIEKEIKDVFAVYGIAVDPRHLSLVADYMCFEGVYKPLNRFGIRSNSSPLQQMTFETSFQFLKQATMLGSHDELRSPSACLVVGKVVRGGTGLFELKQPLR

• Full Name: polymerase (RNA) I polypeptide A, 194kDa
• Calculated Molecular Weight: 1720 aa, 195 kDa
• Observed Molecular Weight: 190-195 kDa
• GenBank Accession Number: BC017115
• Gene Symbol: POLR1A
• Gene ID (NCBI): 25885
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95602
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

POLR1A, DNA-directed RNA polymerase I subunit RPA1, is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA. RNA polymerase I (Pol I) located in the nucleolus and transcribes class I genes, which code for large ribosomal RNA. Different subunits of the Pol I transcription are targets of various physiological stimuli, which suggests that multiple signaling pathways are involved in carrying out Pol I ranscription. Together with the second largest subunit, it is the catalytic core component of RNA polymerase I that synthesizes ribosomal RNA precursors.