POLR1A Recombinant monoclonal antibody, PBS Only

POLR1A Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 85633-1-PBS
Clone No.243082E3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

A190, DNA-directed RNA polymerase I largest subunit, DNA-directed RNA polymerase I subunit A, DNA-directed RNA polymerase I subunit RPA1, EC:2.7.7.6

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85633-1-PBS targets POLR1A in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14543

Product name: Recombinant human RPA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 295-574 aa of BC017115

Sequence: DDEDMQEERNPHREGARKTQEQDEEVGLGTEEDPSLPALLTQPRKPTHSQEPQGPEAMERRVQAVREIHPFIDDYQYDTEESLWCQVTVKLPLMKINFDMSSLVVSLAHGAVIYATKGITRCLLNETTNNKNEKELVLNTEGINLPELFKYAEVLDLRRLYSNDIHAIANTYGIEAALRVIEKEIKDVFAVYGIAVDPRHLSLVADYMCFEGVYKPLNRFGIRSNSSPLQQMTFETSFQFLKQATMLGSHDELRSPSACLVVGKVVRGGTGLFELKQPLR

Predict reactive species
Full Name polymerase (RNA) I polypeptide A, 194kDa
Calculated Molecular Weight 1720 aa, 195 kDa
Observed Molecular Weight190-195 kDa
GenBank Accession NumberBC017115
Gene Symbol POLR1A
Gene ID (NCBI) 25885
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95602
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

POLR1A, DNA-directed RNA polymerase I subunit RPA1, is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA. RNA polymerase I (Pol I) located in the nucleolus and transcribes class I genes, which code for large ribosomal RNA. Different subunits of the Pol I transcription are targets of various physiological stimuli, which suggests that multiple signaling pathways are involved in carrying out Pol I ranscription. Together with the second largest subunit, it is the catalytic core component of RNA polymerase I that synthesizes ribosomal RNA precursors.

Loading...
||
New chat Able
正在加载,请稍候...