RPH3A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RPH3A Polyclonal antibody, PBS Only (11396-1-PBS)

• 

  WB analysis of COLO 320 using 11396-1-AP (same clone as 11396-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 11396-1-AP (RPH3A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11396-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 11396-1-AP (same clone as 11396-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 11396-1-AP (RPH3A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11396-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 11396-1-AP (same clone as 11396-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11396-1-AP (RPH3A antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11396-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 11396-1-AP (same clone as 11396-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11396-1-AP (RPH3A antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11396-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 11396-1-AP (same clone as 11396-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using RPH3A antibody (11396-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 11396-1-PBS in a different storage buffer formulation.

RPH3A Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11396-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Rabphilin 3A, Rabphilin, KIAA0985, Exophilin-1, Exophilin1

---

Product Information

11396-1-PBS targets RPH3A in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1956

  Product name: Recombinant human RPH3A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC017259

  Sequence: MTDTVFSNSSNRWMYPSDRPLQSKLQAGWSVHPGGQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLENMRKNVAGDGVNRCILCGEQLGMLGSACVVCEDCKKNVCTKCGVETNNRLHSVWLCKICIEQREVWKRSGAWFFKGFPKQVLPQPMPIKKTKPQQPVSEPAAPEQPAPEPKHPARAPARGDSEDRRGPGQKTGPDPASAPGRGNYGPPVRRASEARMSSSSRDSESWDHSGGAGDSSRSPAGLRRANSVQASRPAPGSVQSPAPPQPGQPGTPGGSRPGP

• Full Name: rabphilin 3A homolog (mouse)
• Calculated Molecular Weight: 690 aa, 76 kDa
• Observed Molecular Weight: 76 kDa
• GenBank Accession Number: BC017259
• Gene Symbol: RPH3A
• Gene ID (NCBI): 22895
• RRID: AB_2181145
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2J0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAB3A is a small G protein that is thought to act in exocytosis of neurotransmitters and hormones in synaptic neurotransmission and cell-cell communication. RPH3A (RPH3A), a RAB3A effector, is a neuronal C2 domain tandem containing protein that is involved in the neuronal transmitter process. Huntington's disease (HD) is a hereditary neurodegenerative disorder characterized by progressive motor disturbances, cognitive defects and dementia. Level of rabphilin 3A is substantially decreased in synapses of most brain regions in R6/1 transgenic mouse model of HD suggesting a role of RPH3A in impaired synaptic transmission.