RPP25L Polyclonal antibody

• 

  WB analysis using 33447-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33447-1-AP (RPP25L antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

RPP25L Polyclonal Antibody for WB, ELISA

Cat No. 33447-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C9orf23, Ribonuclease P protein subunit p25-like protein, RNase P protein subunit-like p25, Rpp25-like protein

---

Tested Applications

• Positive WB detected in: A-204 cells, A431 cells, BxPC-3 cells, DU 145 cells, Raji cells, Ramos cells, THP-1 cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33447-1-AP targets RPP25L in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37795

  Product name: Recombinant human C9orf23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-163 aa of BC032136

  Sequence: MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS

• Full Name: chromosome 9 open reading frame 23
• Observed Molecular Weight: 17-19 kDa
• GenBank Accession Number: BC032136
• Gene Symbol: C9orf23
• Gene ID (NCBI): 138716
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N5L8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RPP25L (Ribonuclease P protein subunit p25-like protein), also known as C9orf23. RPP25L is a subunit of RNase P complex, which is mainly involved in the processing of tRNA precursor, and is responsible for cutting off the 5' leading sequence of tRNA precursor to generate mature tRNA. In addition, RPP25L may also participate in other RNA metabolism processes, such as the processing of rRNA.