RRAS2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RRAS2 Polyclonal antibody, PBS Only (12530-1-PBS)

• 

  WB analysis of NIH/3T3 using 12530-1-AP (same clone as 12530-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 12530-1-AP (RRAS2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12530-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse pancreas using 12530-1-AP (same clone as 12530-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 12530-1-AP (RRAS2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12530-1-PBS in a different storage buffer formulation.

• 

  IP experiment of NIH/3T3 using 12530-1-AP (same clone as 12530-1-PBS)

  IP result of anti-RRAS2 (IP:12530-1-AP, 4ug; Detection:12530-1-AP 1:800) with NIH/3T3 cells lysate 4000ug. This data was developed using the same antibody clone with 12530-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 12530-1-AP (same clone as 12530-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 12530-1-AP (RRAS2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12530-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 12530-1-AP (same clone as 12530-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 12530-1-AP (RRAS2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12530-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 12530-1-AP (same clone as 12530-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12530-1-AP (RRAS2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12530-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 12530-1-AP (same clone as 12530-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12530-1-AP (RRAS2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12530-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 12530-1-AP (same clone as 12530-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 12530-1-AP (RRAS2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12530-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 12530-1-AP (same clone as 12530-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 12530-1-AP (RRAS2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12530-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 12530-1-AP (same clone as 12530-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 12530-1-AP (RRAS2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 12530-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 12530-1-AP (same clone as 12530-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using RRAS2 antibody (12530-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12530-1-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 12530-1-AP (same clone as 12530-1-PBS)

  1X10^6 A431 cells were intracellularly stained with 0.4 ug Anti-Human RRAS2 (12530-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 12530-1-PBS in a different storage buffer formulation.

RRAS2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 12530-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

EC:3.6.5.-, Ras like protein TC21, Ras related protein R Ras2, Ras-like protein TC21, Ras-related protein R-Ras2

---

Product Information

12530-1-PBS targets RRAS2 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3226

  Product name: Recombinant human RRAS2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-204 aa of BC013106

  Sequence: MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF

• Full Name: related RAS viral (r-ras) oncogene homolog 2
• Calculated Molecular Weight: 204 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC013106
• Gene Symbol: RRAS2
• Gene ID (NCBI): 22800
• RRID: AB_2180206
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62070
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ras-related protein R-Ras2 (RRAS2) is also named TC21 and Teratocarcinoma oncogene. The RRAS2 member of the RAS-related subfamily, also known as TC21, is a close relative of the classic RAS GTPases (PMID: 3898776). RRAS2, a member of the R-Ras subfamily of Ras-like low-molecular-weight GTPases, is located in the plasma membrane and functions as a signal transducer (PMID: 38601074). RRAS2 is GTP-binding protein with GTPase activity, involved in the regulation of MAPK signaling pathway and thereby controlling multiple cellular processes (PMID: 31130282).