Tested Applications
| Positive WB detected in | NIH/3T3 cells, mouse pancreas tissue |
| Positive IP detected in | NIH/3T3 cells |
| Positive IHC detected in | mouse heart tissue, human heart tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12530-1-AP targets RRAS2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3226 Product name: Recombinant human RRAS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-204 aa of BC013106 Sequence: MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF Predict reactive species |
| Full Name | related RAS viral (r-ras) oncogene homolog 2 |
| Calculated Molecular Weight | 204 aa, 23 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC013106 |
| Gene Symbol | RRAS2 |
| Gene ID (NCBI) | 22800 |
| RRID | AB_2180206 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62070 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ras-related protein R-Ras2 (RRAS2) is also named TC21 and Teratocarcinoma oncogene. The RRAS2 member of the RAS-related subfamily, also known as TC21, is a close relative of the classic RAS GTPases (PMID: 3898776). RRAS2, a member of the R-Ras subfamily of Ras-like low-molecular-weight GTPases, is located in the plasma membrane and functions as a signal transducer (PMID: 38601074). RRAS2 is GTP-binding protein with GTPase activity, involved in the regulation of MAPK signaling pathway and thereby controlling multiple cellular processes (PMID: 31130282).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for RRAS2 antibody 12530-1-AP | Download protocol |
| IF protocol for RRAS2 antibody 12530-1-AP | Download protocol |
| IHC protocol for RRAS2 antibody 12530-1-AP | Download protocol |
| IP protocol for RRAS2 antibody 12530-1-AP | Download protocol |
| WB protocol for RRAS2 antibody 12530-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RRAS2 Polyclonal antibody (Cat# 12530-1-AP) has 7 citations published in Cell Death & Differentiation, Clinical Cancer Research, Fertility and Sterility, Cells, Scientific Reports, Journal of Biological Chemistry, and Biochemical Genetics. Research fields include tumorigenesis (lung cancer, breast cancer, head and neck squamous cell carcinoma), ovarian physiology, protein post-translational modification (cysteine acylation), and aerobic glycolysis. All cited applications are Western blot in human, mouse, or monkey samples.
| Species | Application | Title |
|---|---|---|
Cell Death Differ Global identification of phospho-dependent SCF substrates reveals a FBXO22 phosphodegron and an ERK-FBXO22-BAG3 axis in tumorigenesis. | ||
Clin Cancer Res RRAS and RRAS2 Mutations Are Recurrent Oncogenic Drivers in Lung Cancer and Are Sensitive to the Pan-RAS Inhibitor RMC-6236. | ||
Fertil Steril Long-term effects of repeated superovulation on ovarian structure and function in rhesus monkeys. | ||
Cells Co-Inhibition of tGLI1 and GP130 Using FDA-Approved Ketoconazole and Bazedoxifene Is Synergistic Against the Growth and Metastasis of HER2-Enriched and Triple-Negative Breast Cancers | ||
Sci Rep H3 lysine 18 lactylation-mediated RRAS2 facilitates migration and invasion of head and neck squamous cell carcinoma.
| ||
J Biol Chem Competition for cysteine acylation by C16:0 and C18:0 derived lipids is a global phenomenon in the proteome |
