RRM1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86135-1-RR (same clone as 86135-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86135-1-RR (RRM1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86135-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 86135-1-RR (same clone as 86135-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using RRM1 antibody (86135-1-RR, Clone: 250707E6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86135-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 86135-1-RR (same clone as 86135-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using RRM1 antibody (86135-1-RR, Clone: 250707E6 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86135-1-PBS in a different storage buffer formulation.

RRM1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86135-1-PBS

Clone No.250707E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

EC:1.17.4.1, Ribonucleoside-diphosphate reductase large subunit, Ribonucleoside-diphosphate reductase subunit M1, ribonucleotide reductase M1, RIR1

---

Product Information

86135-1-PBS targets RRM1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0789

  Product name: Recombinant human RRM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 593-792 aa of BC006498

  Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS

• Full Name: ribonucleotide reductase M1
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC006498
• Gene Symbol: RRM1
• Gene ID (NCBI): 6240
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23921
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ribonucleoside-diphosphate reductase functions as a heterodimer of a large and a small subunits in deoxyribonucleotide synthesis. RRM1 constitutes to the large subunit (R1) of ribonucleotide reductase, and it can either form heterodimer with small subunit RRM or RRM2B(PMID:16376858). RRM1 provides the precursors necessary for DNA synthesis. RRM1 can not be detected in quiescent cells, while its mRNA and protein are present throughout the cell cycle in cycling cells(PMID:8188248). Researches showed that RRM1 is involved in carcinogenesis, tumor progression, and the resistance of non-small-cell lung cancer (NSCLC) to treatment. Low level expression of RRM1 in NSCLC is associated with poor survival (PMID:17314339).