RRM1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• RRM1 Recombinant monoclonal antibody (86135-1-RR)

RRM1 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86135-1-RR

Clone No.250707E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

EC:1.17.4.1, Ribonucleoside-diphosphate reductase large subunit, Ribonucleoside-diphosphate reductase subunit M1, ribonucleotide reductase M1, RIR1

• 

  WB analysis using 86135-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86135-1-RR (RRM1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 86135-1-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using RRM1 antibody (86135-1-RR, Clone: 250707E6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 86135-1-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using RRM1 antibody (86135-1-RR, Clone: 250707E6 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, A431 cells, HEK-293 cells, K-562 cells, A549 cells
• Positive IF/ICC detected in: HeLa cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86135-1-RR targets RRM1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0789

  Product name: Recombinant human RRM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 593-792 aa of BC006498

  Sequence: IRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMCGS

• Full Name: ribonucleotide reductase M1
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC006498
• Gene Symbol: RRM1
• Gene ID (NCBI): 6240
• RRID: AB_3744652
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23921
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ribonucleoside-diphosphate reductase functions as a heterodimer of a large and a small subunits in deoxyribonucleotide synthesis. RRM1 constitutes to the large subunit (R1) of ribonucleotide reductase, and it can either form heterodimer with small subunit RRM or RRM2B(PMID:16376858). RRM1 provides the precursors necessary for DNA synthesis. RRM1 can not be detected in quiescent cells, while its mRNA and protein are present throughout the cell cycle in cycling cells(PMID:8188248). Researches showed that RRM1 is involved in carcinogenesis, tumor progression, and the resistance of non-small-cell lung cancer (NSCLC) to treatment. Low level expression of RRM1 in NSCLC is associated with poor survival (PMID:17314339).