RRP12 Polyclonal antibody

• 

  WB analysis using 26849-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26849-1-AP (RRP12 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 26849-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RRP12 antibody (26849-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

RRP12 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26849-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

KIAA0690, RRP12, RRP12 like protein

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:100000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26849-1-AP targets RRP12 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25271

  Product name: Recombinant human RRP12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-151 aa of BC012745

  Sequence: MGRSGKLPSGVSAKLKRWKKGHSSDSNPAICRHRQAARSRFFSRPSGRSDLTVDAVKLHNELQSGSLRLGKSEAPETPMEEEAELVLTEKSSGTFLSGLSDCTNVTFSKVQRFWESNSAAHKEICAVLAAVTEVIRSQGGKETETEYFAAL

• Full Name: ribosomal RNA processing 12 homolog (S. cerevisiae)
• Calculated Molecular Weight: 1297 aa, 144 kDa
• Observed Molecular Weight: 144-150 kDa
• GenBank Accession Number: BC012745
• Gene Symbol: RRP12
• Gene ID (NCBI): 23223
• RRID: AB_3669571
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5JTH9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.