RRP12 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RRP12 Polyclonal antibody (26849-1-AP)

RRP12 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26849-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

KIAA0690, RRP12, RRP12 like protein

• 

  WB analysis using 26849-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26849-1-AP (RRP12 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 26849-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RRP12 antibody (26849-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RRP12 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:100000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26849-1-AP targets RRP12 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25271

  Product name: Recombinant human RRP12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-151 aa of BC012745

  Sequence: MGRSGKLPSGVSAKLKRWKKGHSSDSNPAICRHRQAARSRFFSRPSGRSDLTVDAVKLHNELQSGSLRLGKSEAPETPMEEEAELVLTEKSSGTFLSGLSDCTNVTFSKVQRFWESNSAAHKEICAVLAAVTEVIRSQGGKETETEYFAAL

• Full Name: ribosomal RNA processing 12 homolog (S. cerevisiae)
• Calculated Molecular Weight: 1297 aa, 144 kDa
• Observed Molecular Weight: 144-150 kDa
• GenBank Accession Number: BC012745
• Gene Symbol: RRP12
• Gene ID (NCBI): 23223
• RRID: AB_3669571
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5JTH9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RRP12 Polyclonal antibody (Cat# 26849-1-AP) has 1 total citation. It was cited in Cell Reports (Impact Factor 7.7) in a study titled "Nucleoplasmic checkpoint of the 40S ribosomal decoding center maturation" by Benjamin Lau (2026). The research field is ribosome biogenesis and RNA processing, specifically examining the role of RRP12 in 40S ribosomal subunit maturation within the nucleoplasm.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Rep; Nucleoplasmic checkpoint of the 40S ribosomal decoding center maturation.; Authors - Benjamin Lau