RRP36 Polyclonal antibody

• 

  WB analysis of MCF-7 using 25440-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 25440-1-AP (RRP36 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 25440-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25440-1-AP (RRP36 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of MCF-7 using 25440-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed MCF-7 cells using 25440-1-AP (RRP36 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

RRP36 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25440-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

C6orf153, HSPC253, RRP36

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HEK-293 cells
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25440-1-AP targets RRP36 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22014

  Product name: Recombinant human C6orf153 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-259 aa of BC011933

  Sequence: MPGANYRAGAGAGAGARRPRGARDREEDGGGLEPAAVARDLLRGTSNMSFEELLELQSQVGTKTYKQLVAGNSPKKQASRPPIQNACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHLSGEEHEKLQQLLQRMEQQEMAQQERKQQQELHLALKQERRAQAQQGHRPYFLKKSEQRQLALAEKFKELKRSKKLENFLSRKRRRNAGKDRRHLPLSKE

• Full Name: chromosome 6 open reading frame 153
• Calculated Molecular Weight: 259 aa, 30 kDa
• Observed Molecular Weight: 30-40 kDa
• GenBank Accession Number: BC011933
• Gene Symbol: RRP36
• Gene ID (NCBI): 88745
• RRID: AB_2880082
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96EU6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.