RRP36 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RRP36 Polyclonal antibody (25440-1-AP)

RRP36 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25440-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

C6orf153, HSPC253, RRP36

• 

  WB analysis of MCF-7 using 25440-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 25440-1-AP (RRP36 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 25440-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25440-1-AP (RRP36 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 25440-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed MCF-7 cells using 25440-1-AP (RRP36 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RRP36 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HEK-293 cells
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25440-1-AP targets RRP36 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22014

  Product name: Recombinant human C6orf153 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-259 aa of BC011933

  Sequence: MPGANYRAGAGAGAGARRPRGARDREEDGGGLEPAAVARDLLRGTSNMSFEELLELQSQVGTKTYKQLVAGNSPKKQASRPPIQNACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHLSGEEHEKLQQLLQRMEQQEMAQQERKQQQELHLALKQERRAQAQQGHRPYFLKKSEQRQLALAEKFKELKRSKKLENFLSRKRRRNAGKDRRHLPLSKE

• Full Name: chromosome 6 open reading frame 153
• Calculated Molecular Weight: 259 aa, 30 kDa
• Observed Molecular Weight: 30-40 kDa
• GenBank Accession Number: BC011933
• Gene Symbol: RRP36
• Gene ID (NCBI): 88745
• RRID: AB_2880082
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96EU6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RRP36 Polyclonal antibody (Cat# 25440-1-AP) has 2 total citations. These appear in Nature Chemical Biology (IF 15.8) and Nucleic Acids Research (IF 15). The cited research fields include targeted protein degradation and degron display, as well as HIV virology and nucleolar stress signaling pathways. Both citations used the antibody for Western blot in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Chem Biol; Charged molecular glue discovery enabled by targeted degron display.; Authors - Zhe Zhuang
human	WB	Nucleic Acids Res; HIV Vpr activates a nucleolar-specific ATR pathway to degrade the nucleolar stress sensor CCDC137; Authors - Karly A Nisson