RRP36 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RRP36 Polyclonal antibody, PBS Only (25440-1-PBS)

• 

  WB analysis of MCF-7 using 25440-1-AP (same clone as 25440-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 25440-1-AP (RRP36 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25440-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 25440-1-AP (same clone as 25440-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25440-1-AP (RRP36 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25440-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 25440-1-AP (same clone as 25440-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed MCF-7 cells using 25440-1-AP (RRP36 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25440-1-PBS in a different storage buffer formulation.

RRP36 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 25440-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

25440-1-PBS targets RRP36 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22014

  Product name: Recombinant human C6orf153 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-259 aa of BC011933

  Sequence: MPGANYRAGAGAGAGARRPRGARDREEDGGGLEPAAVARDLLRGTSNMSFEELLELQSQVGTKTYKQLVAGNSPKKQASRPPIQNACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDPRFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHLSGEEHEKLQQLLQRMEQQEMAQQERKQQQELHLALKQERRAQAQQGHRPYFLKKSEQRQLALAEKFKELKRSKKLENFLSRKRRRNAGKDRRHLPLSKE

• Full Name: chromosome 6 open reading frame 153
• Calculated Molecular Weight: 259 aa, 30 kDa
• Observed Molecular Weight: 30-40 kDa
• GenBank Accession Number: BC011933
• Gene Symbol: RRP36
• Gene ID (NCBI): 88745
• RRID: AB_2880082
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96EU6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.