CoraLite® Plus 488-conjugated RS1 Polyclonal antibody

RS1 Polyclonal Antibody for IF/ICC
Cat No. CL488-24430

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Retinoschisin, retinoschisin 1, RS, RS1, XLRS1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inhTERT-RPE1 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-24430 targets RS1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18885

Product name: Recombinant human RS1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 25-224 aa of BC141638

Sequence: TEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA

Predict reactive species
Full Name retinoschisin 1
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC141638
Gene Symbol RS1
Gene ID (NCBI) 6247
RRIDAB_3084081
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15537
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

RS1 is also named as XLRS1. RS1 can bind negatively charged membrane lipids, such as phosphatidylserine and phosphoinositides. RS1 is required for normal structure and function of the retina (PMID:19093009). It may play a role in cell-cell adhesion processes in the retina (PMID:27114531). RS1 is high expression in the retina (at protein level) (PMID:10915776, PMID:9326935). It is detected in the inner segment of the photoreceptors, the inner nuclear layer, the inner plexiform layer and the ganglion cell layer. At the macula, it is expressed in both the outer and inner nuclear layers and in the inner plexiform layer (PMID:10915776, PMID:10915776). And RS1 is undetectable in the inner plexiform layers and the inner nuclear layer (PMID:10915776)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 RS1 antibody CL488-24430Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...