RSAD2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• RSAD2 Monoclonal antibody (68604-1-Ig)

RSAD2 Monoclonal Antibody for WB, ELISA

Cat No. 68604-1-Ig Copied!

Clone No. 1C5D4

Publications (5)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig

Applications

WB, IF, ELISA

Synonyms

1C5D4, CIG5, Cytomegalovirus-induced gene 5 protein, EC:4.2.-.-, Radical S-adenosyl methionine domain-containing protein 2

• 

  WB analysis of pig liver using 68604-1-Ig

  pig liver tissue were subjected to SDS PAGE followed by western blot with 68604-1-Ig (RSAD2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 68604-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68604-1-Ig (RSAD2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RSAD2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: pig liver tissue, mouse liver tissue, mouse brain tissue, pig spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68604-1-Ig targets RSAD2 in WB, IF, ELISA applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Cited Reactivity: mouse, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27733

  Product name: Recombinant human RSAD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 181-361 aa of BC017969

  Sequence: DSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW

• Full Name: radical S-adenosyl methionine domain containing 2
• Calculated Molecular Weight: 361 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC017969
• Gene Symbol: RSAD2
• Gene ID (NCBI): 91543
• RRID: AB_3085300
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8WXG1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RSAD2 (radical S-adenosyl methionine domain-containing protein 2), also known as CIG5 (cytomegalovirus-induced gene 5 protein), vig1, viperin or CIG33, displays antiviral effect against HIV-1 virus, hepatitis C virus, human cytomegalovirus, and aphaviruses. Expression of the protein can be induced by interferon.

Publications

What published studies show

The RSAD2 Monoclonal antibody (1C5D4), catalog number 68604-1-Ig, has 5 total citations. These appear in International Journal of Biological Macromolecules, Journal of Immunology, Veterinary Microbiology (two papers), and Virulence. The research fields span antiviral immunity and viral replication (coronavirus, Senecavirus A, PDCoV), type I interferon signaling, cGAS-STING/NF-κB pathways, mitochondrial protection in microglia, and lipid droplet dynamics in viral suppression.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB,IF	Int J Biol Macromol; Viperin inhibits coronavirus replication by targeting non-structural protein 8 to disrupt replication-transcription complex assembly and RNA-dependent RNA polymerase activity.; Authors - Juan Li
mouse	WB	J Immunol; LRRK2 kinase activity restricts NRF2-dependent mitochondrial protection in microglia.; Authors - Chi G Weindel
pig	WB	Vet Microbiol; RSAD2 inhibits Senecavirus A replication by promoting type I interferons induction downstream of cGAS-STING and NF-κB signaling pathway.; Authors - Huizi Li
	WB	Vet Microbiol; Lipid droplet dynamics control type I interferon responses and viperin expression to suppress viral replication.; Authors - Zhenbang Zhu
		Virulence; Integrated multi-omics analysis identifies PPAR signaling network associations with metabolic-immune dysregulation and intestinal injury in PDCoV-infected piglets.; Authors - Xingchen Guo