RSAD2 Monoclonal antibody

• 

  WB analysis of pig liver using 68604-1-Ig

  pig liver tissue were subjected to SDS PAGE followed by western blot with 68604-1-Ig (RSAD2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 68604-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68604-1-Ig (RSAD2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

RSAD2 Monoclonal Antibody for WB, ELISA

Cat No. 68604-1-Ig

Clone No.1C5D4

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, pig

Applications

WB, ELISA

Synonyms

2510004L01Rik, cig33, cig5, RSAD2, vig1, Viperin

---

Tested Applications

• Positive WB detected in: pig liver tissue, mouse liver tissue, mouse brain tissue, pig spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68604-1-Ig targets RSAD2 in WB, ELISA applications and shows reactivity with Human, mouse, pig samples.

• Tested Reactivity: Human, mouse, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27733

  Product name: Recombinant human RSAD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 181-361 aa of BC017969

  Sequence: DSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW

• Full Name: radical S-adenosyl methionine domain containing 2
• Calculated Molecular Weight: 361 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC017969
• Gene Symbol: RSAD2
• Gene ID (NCBI): 91543
• RRID: AB_3085300
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8WXG1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RSAD2 (radical S-adenosyl methionine domain-containing protein 2), also known as CIG5 (cytomegalovirus-induced gene 5 protein), vig1, viperin or CIG33, displays antiviral effect against HIV-1 virus, hepatitis C virus, human cytomegalovirus, and aphaviruses. Expression of the protein can be induced by interferon.