RSAD2 Monoclonal antibody, PBS Only

• 

  WB analysis of pig liver using 68604-1-Ig (same clone as 68604-1-PBS)

  pig liver tissue were subjected to SDS PAGE followed by western blot with 68604-1-Ig (RSAD2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68604-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68604-1-Ig (same clone as 68604-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68604-1-Ig (RSAD2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68604-1-PBS in a different storage buffer formulation.

RSAD2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68604-1-PBS

Clone No.1C5D4

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, pig

Applications

WB, Indirect ELISA

Synonyms

2510004L01Rik, cig33, cig5, RSAD2, vig1, Viperin

---

Product Information

68604-1-PBS targets RSAD2 in WB, Indirect ELISA applications and shows reactivity with Human, mouse, pig samples.

• Tested Reactivity: Human, mouse, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27733

  Product name: Recombinant human RSAD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 181-361 aa of BC017969

  Sequence: DSFDEEVNVLIGRGQGKKNHVENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYIWSKADLKLDW

• Full Name: radical S-adenosyl methionine domain containing 2
• Calculated Molecular Weight: 361 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC017969
• Gene Symbol: RSAD2
• Gene ID (NCBI): 91543
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8WXG1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RSAD2 (radical S-adenosyl methionine domain-containing protein 2), also known as CIG5 (cytomegalovirus-induced gene 5 protein), vig1, viperin or CIG33, displays antiviral effect against HIV-1 virus, hepatitis C virus, human cytomegalovirus, and aphaviruses. Expression of the protein can be induced by interferon.