RSBN1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RSBN1 Polyclonal antibody (24734-1-AP)

• 

  WB analysis using 24734-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24734-1-AP (RSBN1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 24734-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using RSBN1 antibody (24734-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of HeLa using 24734-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using RSBN1 antibody (24734-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

RSBN1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 24734-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

ROSBIN, Rsbn, RSBN 1, Rsbp

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, PC-3 cells
• Positive IF/ICC detected in: HeLa cells, A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24734-1-AP targets RSBN1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20895

  Product name: Recombinant human RSBN1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-411 aa of BC026155

  Sequence: MAAQVGAVRVVRAVAAQEEPDKEGKEKPHAGVSPRGVKRQRRSSSGGSQEKRGRPSQEPPLAPPHRRRRSRQHPGPLPPTNAAPTVPGPVEPLLLPPPPPPSLAPAGPAVAAPLPAPSTSALFTFSPLTVSAAGPKHKGHKERHKHHHHRGPDGDPSSCGTDLKHKDKQENGERTGGVPLIKAPKRETPDENGKTQRADDFVLKKIKKKKKKKHREDMRGRRLKMYNKEVQTVCAGLTRISKEILTQGQINSTSGLNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAYYALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILGKKDIETTTISNFHTQ

• Full Name: round spermatid basic protein 1
• Calculated Molecular Weight: 411 aa, 46 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC026155
• Gene Symbol: RSBN1
• Gene ID (NCBI): 54665
• RRID: AB_3742124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VWQ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RSBN1 is expressed not only in the testes, but also in the brain and ovaries. RSBN1 could play a role in both meiotic and post-meiotic progression, suggesting that it may also be involved in oogenesis. On the other hand, RSBN1 may be involved in brain development and function, as well as the regulation of neuronal cells, since another H4K20 demethylase, PHF8, regulates neuronal cell survival and brain development, while LSD1 regulates memory formation (PMID: 20622853, 26214369, 34185806).