RSL24D1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• RSL24D1 Polyclonal antibody, PBS Only (25190-1-PBS)

• 

  WB analysis of HepG2 using 25190-1-AP (same clone as 25190-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 25190-1-AP (RSL24D1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25190-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 25190-1-AP (same clone as 25190-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25190-1-AP (RSL24D1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25190-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 25190-1-AP (same clone as 25190-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 25190-1-AP (RSL24D1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25190-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 25190-1-AP (same clone as 25190-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 25190-1-AP (RSL24D1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25190-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 25190-1-AP (same clone as 25190-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using RSL24D1 antibody (25190-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 25190-1-PBS in a different storage buffer formulation.

RSL24D1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 25190-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

C15orf15, HRP L30 iso, L30, My024, Ribosomal L24 domain-containing protein 1

---

Product Information

25190-1-PBS targets RSL24D1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18195

  Product name: Recombinant human RSL24D1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-163 aa of BC008409

  Sequence: MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQEDVDMEDAP

• Full Name: ribosomal L24 domain containing 1
• Calculated Molecular Weight: 163 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC008409
• Gene Symbol: RSL24D1
• Gene ID (NCBI): 51187
• RRID: AB_2879950
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHA3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RSL24D1 (Ribosomal L24 Domain Containing 1) is a ribosomal protein that is primarily localized in the nucleolus and is involved in the biogenesis of the 60S ribosomal subunit. In mouse embryonic stem cells (ESCs), the expression level of RSL24D1 is high and significantly decreases during cell differentiation. The role of RSL24D1 in ribosome biogenesis includes facilitating proper protein docking in nucleolar and cytoplasmic precursor particles. After the completion of biogenesis, RSL24D1 dissociates from the particles and is thought to be replaced by ribosomal protein L24.