RSPO1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RSPO1 Polyclonal antibody (25348-1-AP)

RSPO1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25348-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

CRISTIN3, hRspo1, R spondin 1, Roof plate specific spondin 1, RSPO, RSPO1

• 

  WB analysis of human plasma using 25348-1-AP

  human plasma were subjected to SDS PAGE followed by western blot with 25348-1-AP (RSPO1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat plasma using 25348-1-AP

  rat plasma were subjected to SDS PAGE followed by western blot with 25348-1-AP (RSPO1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 25348-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 25348-1-AP (RSPO1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 25348-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 25348-1-AP (RSPO1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RSPO1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human plasma, rat plasma
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25348-1-AP targets RSPO1 in WB, IHC, IF, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21858

  Product name: Recombinant human RSPO1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-263 aa of BC114966

  Sequence: MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

• Full Name: R-spondin homolog (Xenopus laevis)
• Calculated Molecular Weight: 263 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC114966
• Gene Symbol: RSPO1
• Gene ID (NCBI): 284654
• RRID: AB_2880038
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2MKA7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RSPO1, also named R-spondin-1, Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential role in ovary determination. Regulates Wnt signaling by antagonizing DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1. RSPO1 seems to mainly localize to nucleoli (PMID:17804805).

Publications

What published studies show

The RSPO1 Polyclonal antibody (Cat# 25348-1-AP) has 6 citations published in Cardiovascular Research, Pharmacological Research, Journal of Experimental Medicine, American Journal of Human Genetics, International Journal of Molecular Sciences, and Frontiers in Molecular Biosciences. The research fields span cardiovascular disease (atherosclerosis), regenerative medicine (MSC therapy), intestinal stem cell biology, ovarian cancer, protein glycosylation, and cervical cancer.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cardiovasc Res; Role of R-spondin 2 in arterial lymphangiogenesis and atherosclerosis.; Authors - Bhupesh Singla
		Pharmacol Res; Targeted MSC therapy restores implantation by spatially reconstituting the RSPO1 niche via IL10-CXCL12 signaling.; Authors - Yue Dang
mouse	WB,IF	J Exp Med; Transit-amplifying cells control R-spondins in the mouse crypt to modulate intestinal stem cell proliferation; Authors - Almudena Chaves-Pérez
human	WB	Am J Hum Genet; Functional analysis of the 1p34.3 risk locus implicates GNL2 in high-grade serous ovarian cancer.; Authors - Koji Nakamura
human	WB	Int J Mol Sci; PMID: 27314333; Authors - Chiung-Fang Chang
human	WB	Front Mol Biosci; A Novel Identified Long Non-coding RNA, lncRNA MEF2C-AS1, Inhibits Cervical Cancer via Regulation of miR-592/RSPO1.; Authors - Xiaoping Wang