RSPO1 Polyclonal antibody

• 

  WB analysis of human plasma using 25348-1-AP

  human plasma were subjected to SDS PAGE followed by western blot with 25348-1-AP (RSPO1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat plasma using 25348-1-AP

  rat plasma were subjected to SDS PAGE followed by western blot with 25348-1-AP (RSPO1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 25348-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 25348-1-AP (RSPO1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 25348-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 25348-1-AP (RSPO1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RSPO1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25348-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (1)

Applications

WB, IF, IHC, ELISA

Synonyms

CRISTIN3, hRspo1, R spondin 1, Roof plate specific spondin 1, RSPO, RSPO1

---

Tested Applications

• Positive WB detected in: human plasma, rat plasma
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IF: See 1 publications below

Product Information

25348-1-AP targets RSPO1 in WB, IF, IHC, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21858

  Product name: Recombinant human RSPO1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-263 aa of BC114966

  Sequence: MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

• Full Name: R-spondin homolog (Xenopus laevis)
• Calculated Molecular Weight: 263 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC114966
• Gene Symbol: RSPO1
• Gene ID (NCBI): 284654
• RRID: AB_2880038
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q2MKA7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RSPO1, also named R-spondin-1, Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential role in ovary determination. Regulates Wnt signaling by antagonizing DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1. RSPO1 seems to mainly localize to nucleoli (PMID:17804805).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Am J Hum Genet; Functional analysis of the 1p34.3 risk locus implicates GNL2 in high-grade serous ovarian cancer.; Authors - Koji Nakamura
human	WB	Cardiovasc Res; Role of R-spondin 2 in arterial lymphangiogenesis and atherosclerosis.; Authors - Bhupesh Singla
human	WB	Front Mol Biosci; A Novel Identified Long Non-coding RNA, lncRNA MEF2C-AS1, Inhibits Cervical Cancer via Regulation of miR-592/RSPO1.; Authors - Xiaoping Wang
human	WB	Int J Mol Sci; PMID: 27314333; Authors - Chiung-Fang Chang
mouse	WB,IF	J Exp Med; Transit-amplifying cells control R-spondins in the mouse crypt to modulate intestinal stem cell proliferation; Authors - Almudena Chaves-Pérez