RSPO3 Monoclonal antibody

RSPO3 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66314-1-Ig
Clone No.1E4F1

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Protein with TSP type-1 repeat, Protein with TSP type 1 repeat, hRspo3, hPWTSR, CRISTIN1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman skeletal muscle tissue, A549 cells
Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66314-1-Ig targets RSPO3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9899

Product name: Recombinant human RSPO3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 27-272 aa of BC022367

Sequence: GRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH

Predict reactive species
Full Name R-spondin 3 homolog (Xenopus laevis)
Calculated Molecular Weight 272 aa, 31 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC022367
Gene Symbol RSPO3
Gene ID (NCBI) 84870
RRIDAB_2881695
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BXY4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RSPO3, also named as R-spondin-3, is a 272 amino acid protein, which contains 1 TSP type-1 domain and 2 FU (furin-like) repeats. RSPO3 may be a secreted protein and belongs to the R-spondin family. RSPO3 is expressed at higher level in placenta, small intestine, fetal thymus and lymph node. RSPO3 is an activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. The four R-spondins (RSPO1-4) and three related leucinerich repeat-containing G-protein coupled receptors, LGR4, LGR5, and LGR6 (LGR4-6), constitute a ligand-receptor system that plays critical roles in development, stem cell survival, and oncogenesis. Ectopic expression of RSPO2/3in mouse mammary epithelial cells led to an increase in invasiveness in vitro and in tumor formation and metastasis in vivo.

Protocols

Product Specific Protocols
WB protocol for RSPO3 antibody 66314-1-IgDownload protocol
IHC protocol for RSPO3 antibody 66314-1-IgDownload protocol
IF protocol for RSPO3 antibody 66314-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...